Suppliers
Contact Us
GENTAUR Europe BVBA Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45 Fax 0032 16 50 90 45 This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it. |
GENTAUR BULGARIA
53 Iskar Str. 1191 Kokalyane, Sofia
Tel 0035924682280
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50
Fax 01 43 25 01 60
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GmbH Marienbongard 20
52062 Aachen Deutschland
Tel (+49) 0241 56 00 99 68
Fax (+49) 0241 56 00 47 88 This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-family: Arial, Tahoma, Verdana, Helvetica; line-height: 15.59375px; ">
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-size: 12px; line-height: 1.3em;">
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531
Fax 020 8445 9411
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Poland Sp. z o.o.
ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
Tel 058 710 33 44
Fax 058 710 33 48
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Nederland BV
Kuiper 1
5521 DG Eersel Nederland
Tel 0208-080893
Fax 0497-517897
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6, 24122 Bergamo
Tel 02 36 00 65 93
Fax 02 36 00 65 94
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Spain
Tel 0911876558
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
Phone/Fax:
(408) 780-0908
This email address is being protected from spambots. You need JavaScript enabled to view it.
GENPRICE Inc. invoicing/ accounting:
6017 Snell Ave, Suite 357
San Jose, CA. 96123
Serbia, Macedonia,
Montenegro, Croatia:
Tel 0035929830070
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Romania
Tel 0035929830070
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Greece
Tel 00302111768494
Fax 0032 16 50 90 45
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
Other countries
Luxembourg +35220880274
Schweiz Züri +41435006251
Danmark +4569918806
Österreich +43720880899
Ceská republika Praha +420246019719
Ireland Dublin +35316526556
Norge Oslo +4721031366
Finland Helsset +358942419041
Sverige Stockholm +46852503438
Magyarország Budapest +3619980547
Uracil DNA-Glycosilase (UDGase)
Cat. num.: BIO-27044
Quantity: 500 Units
Description
Uracil DNA Glycosylase (UDG) catalyzes the release of uracil from uracil-containing single or double-stranded DNA, but not from RNA or oligonucleotides (6 or fewer bases). UDG is active over a broad pH range with an optimum at pH 8.0, does not require a divalent cation, and is inhibited by high ionic strength (>200mM).
UDG is purified to SDS-PAGE purity and is free of endonucleases, exonucleases, nickases and RNases.
Source: Recombinant E. coli strain carrying the over-expressed modified gene of Uracil DNA Glycosylase from E. coli.
Features
• Removal of uracil from uracil-containing DNA
• Novel temperature sensitive mutant irreversibly inactive after
heating
Applications
• UDG treatment of uracil-containing DNA to prevent
amplification by DNA Polymerases
• Used to investigate features of protein-DNA interactions
Storage and stability:
Uracil DNA Glycosylase (UDG) is shipped on Dry/Blue Ice. It should be stored at -20°C upon receipt. When stored under optimum conditions, the reagents are stable for 24 months from date of purchase.
Storage and Dilution Buffer:
20mM Tris-Cl, pH 8.0, 0.1M NaCl, 0.1mM EDTA, 1mM DTT, 0.1% stabilizer and 50% glycerol.
Price: 57 €
Recombinant proteins
Recombinant Human IL-4 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15000 Dalton. The rHuIL-4 is purified by proprietary chromatographic techniques.
Recombinant human interleukin-2 is a sterile protein product for injection. rHuIL-2 is produced by recombinant DNA technology using Yeast. It is a highly purified protein containing 133 amino acids, with cysteine mutated to alanine at 125 amino acid position, and has a molecular weight of approximately 15.4kD, non-glycosylated.
Recombinant human GM-CSF produced in E.coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids, two pairs of disulfide bonds and having a molecular mass of approximately 14.5kD.
Pricelist:
WESTERN BLOTS
Western blotting allows visualization of antibodies directed against specific viral proteins.
- Available for SIV, HTLV I/II, HIV and Helicobacter pylori
- Easy to use, complete kits containing everything needed for antibody detection
- Nitrocellulose strips available for use with your own detection system*
*for SIV and HTLV I/II
SIV BLOT
SIV STRIPS
Simian Immunodeficiency Virus (SIV) is the most closely related lentivirus to Human Immunodeficiency (HIV), therefore, SIV infection in monkeys has become the best animal model for studying the pathogenesis and efficacy of vaccines against HIV infection in humans. The SIV Western Blot assay is a qualitative enzyme immunoassay for the in vitro detection of antibodies to SIV in serum or plasma.
HTLV BLOT 2.4*
HTLV I/II STRIPS
The MP Biomedicals ® HTLV BLOT 2.4 is a qualitative enzyme immunoassay for detecting antibodies to HTLV-I and HTLV-II in human serum or plasma. The HTLV blot 2.4 incorporates MTA-1, a unique HTLV-1 envelope recombinant protein (rgp46-I), K55, a unique HTLV-II envelope recombinant protein (rgp46-II) and GD21, a common yet specific HTLV-I and HTLV-II epitope recombinant protein on the blot. This test is supplied for research purposes only.
HELICO BLOT 2.1*
The MP Biomedicals ® HELICO BLOT 2.1 Western blot kit is a qualitative assay for the detection of IgG antibodies to Helicobacter pylori (H. pylori) in human serum or plasma. In addition to bacterial lysate there is a recombinant antigen with high predictive value for the indication of current H. pylori infection. The assay is intended for use as a serological test for the detection of both current and past infection with H. pylori. Unlike an ELISA, the HELICO BLOT 2.1 allows for the detection of antibodies to specific proteins of H. pylori, including antigens associated with pathology such as CagA and VacA. This kit is supplied for research purposes only.
Click here for more information
HIV-1 BLOT 1.3 *
The MP Biomedicals ® HIV-1 BLOT 1.3 is a qualitative enzyme immunoassay for the detection of antibodies to HIV-1 in human serum or plasma. The assay supplied for research use only and is not intended for use in diagnosis and prognosis of disease.
Recombinant Protein
Product Name: |
Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
|
Product Type: | Recombinant Protein | |
Application: | Immunogen,ELISA | |
Code: | CSB-YP321587AXQ >> Yeast CSB-EP321587AXQ >> E.coli CSB-BP321587AXQ >> Baculovirus CSB-MP321587AXQ >> Mammalian cell |
|
Size: | 1mg | |
Protein Names: | Recommended name: 37 kDa salivary gland allergen Aed a 2 Alternative name(s): Protein D7 Allergen= Aed a 2 |
|
Gene Names: | Name:D7 ORF Names:AAEL006424 |
|
Species: |
Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
|
Product Info: | His tagged | |
Purity: | >90% | |
Storage Buffer: | PBS pH 7.4, 50% glycerol | |
Storage: | Store at -20℃, for extended storage, conserve at -20℃ or -80℃. | |
Notes: | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. | |
AA sequence: |
STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA FNLPKKQVYSKPAVQSQVMEIDGK QCPQ |
|
Expression Region: | 18-321 | |
Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
CSB-YP321587AXQ >> Yeast € 2090/ mg
CSB-EP321587AXQ >> E.coli € 1680/ mg
CSB-BP321587AXQ >> Baculovirus € 2540/200ug
CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
Expression Region :18-321aa;full length.