Suppliers
Contact Us
Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45 Fax 0032 16 50 90 45 This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it. |
GENTAUR BULGARIA
53 Iskar Str. 1191 Kokalyane, Sofia
Tel 0035924682280
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50
Fax 01 43 25 01 60
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GmbH Marienbongard 20
52062 Aachen Deutschland
Tel (+49) 0241 56 00 99 68
Fax (+49) 0241 56 00 47 88 This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-family: Arial, Tahoma, Verdana, Helvetica; line-height: 15.59375px; ">
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-size: 12px; line-height: 1.3em;">
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531
Fax 020 8445 9411
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Poland Sp. z o.o.
ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
Tel 058 710 33 44
Fax 058 710 33 48
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Nederland BV
Kuiper 1
5521 DG Eersel Nederland
Tel 0208-080893
Fax 0497-517897
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6, 24122 Bergamo
Tel 02 36 00 65 93
Fax 02 36 00 65 94
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Spain
Tel 0911876558
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
Phone/Fax:
(408) 780-0908
This email address is being protected from spambots. You need JavaScript enabled to view it.
GENPRICE Inc. invoicing/ accounting:
6017 Snell Ave, Suite 357
San Jose, CA. 96123
Serbia,
Macedonia,
Montenegro,
Croatia:
Tel 0035929830070
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Romania
Tel 0035929830070
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
GENTAUR Greece
Tel 00302111768494
Fax 0032 16 50 90 45
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.
Other countries
Luxembourg +35220880274
Schweiz Züri +41435006251
Danmark +4569918806
Österreich +43720880899
Ceská republika Praha +420246019719
Ireland Dublin +35316526556
Norge Oslo +4721031366
Finland Helsset +358942419041
Sverige Stockholm +46852503438
Magyarország Budapest +3619980547
10% Discount on Markers
Gentaur is now offering 10% summer discount on Markers (for September 2013)

| Cat. | Product | Quantity | Old Price | Promo Price | Order |
| GFP-1020 | Green Fluorescent Protein 4.0 mg | 10x400 ul @ 10.0 mg/ml | 317 € | ||
| TUJ | Beta-Tubulin 3 ("TUJ1 Antigen"), Neuron Cell Marker | 10x300 ug | 326 € | ||
| NUN | Neu-N (Fox 3), Neuron Cell Marker | 10x100 ug | 326 € | ||
| MAP | Microtubule-Associated Protein (MAP-2), Neuron Cell Marker | 10x200 ug | 326 € | ||
| MBP | Meylin Basic Protein (MBP), Neuron Cell Marker | 10x100 ug | 326 € | ||
| CAT | Choline Acetyltransferase (ChAT), Neuron Cell Marker | 10x100 ug | 326 € | ||
| TYH | Tyrosine Hydroxylase (TYH), Neuron Cell Marker | 10x200 ug | 326 € | ||
| NES | Nestin, Stemcell Marker | 10x300 ug | 326 € | ||
| PZO | P-Zero Myelin Protein (PZO), Schwann Cell Marker | 10x200 ug | 326 € | ||
| GFAP | Glial Fibrillary Acidic Protein (GFAP), Astrocyte Marker | 10x200 ul @ 2.0 mg/ml. | 199 € |
Cultrex® 3-D Spheroid Colorimetric Proliferation/Viability Assay
The 3-D Spheroid Colorimetric Proliferation/Viability Assay provides a useful tool for modeling tumor response in vitro. The kit utilizes a 3-D Culture Qualified 96 Well Spheroid Formation Plate alongside a specialized Spheroid Formation ECM to drive aggregation and/or spheroid formation of cells. Upon completion of spheroid formation, the spheroid may be treated with pharmacological agents to evaluate tumor viability after drug treatment. Tumor spheroid expansion is visualized microscopically and can be quantitated through image analysis software for real-time and label free evaluation. At the conclusion of the assay, cell viability may be assessed by absorbance using MTT. The 3-D Spheroid Colorimetric Proliferation/Viability Assay offers an in vitro, standardized, threedimensional, high content format for inducing multicellular tumor spheroid (MCTS) formation and quantitating cell viability within the spheroids in response to pharmacological treatment.
| Catalog # | Product Name | Size |
| 3511-096-K | Cultrex® 3-D Spheroid Colorimetric Proliferation/Viability Assay | 96 samples |
Cultrex® 3-D Spheroid Fluorometric Proliferation/Viability Assay
The 3-D Spheroid Fluorometric Proliferation/Viability Assay provides a useful tool for modeling tumor response in vitro. The kit utilizes a 3-D Culture Qualified 96 Well Spheroid Formation Plate alongside a specialized Spheroid Formation ECM to drive aggregation and/or spheroid formation of cells. Upon completion of spheroid formation, the spheroid may be treated with pharmacological agents to evaluate tumor viability after drug treatment. Tumor spheroid expansion is visualized microscopically and can be quantitated through image analysis software for real-time and label free evaluation. At the conclusion of the assay, cell viability may be assessed by fluorescence using Resazurin. The 3-D Spheroid Fluorometric Proliferation/Viability Assay offers an in vitro, standardized, three-dimensional, high content format for inducing multicellular tumor spheroid (MCTS) formation and quantitating cell viability within the spheroids in response to pharmacological treatment.
| Catalog # | Product Name | Size |
| 3510-096-K | Cultrex® 3-D Spheroid Fluorometric Proliferation/Viability Assay | 96 samples |
Phrixotoxin 3 (Paurtx 3)
Phrixotoxin-3: properties
Phrixotoxin-3 (PaurTx3 or Beta-theraphotoxin-Ps1a) is a valuable pharmacological tool to study voltage-gated sodium channels. This peptide, originally issued from the venom of the tarantula phrixotrichus auratus, has been shown to inhibit Nav1.1, Nav1.2, Nav1.3, Nav1.4 and Nav1.5 with respective IC50 values of 610 nM, 0.6 nM, 42 nM, 288 nM and 72 nM. It is thus considered as one of the most potent and almost selective modulator of Nav1.2.
Product Specification
AA sequence: Asp-Cys2-Leu-Gly-Phe-Leu-Trp-Lys-Cys9-Asn-Pro-Ser-Asn-Asp-Lys-Cys16-Cys17-Arg-Pro-Asn-Leu-Val-Cys23-Ser-Arg-Lys-Asp-Lys-Trp-Cys30-Lys-Tyr-Gln-Ile-OH
Disulfide bridges: Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30
Length (aa): 34
Formula: C171H245N53O47S6
Molecular Weight: 4059.9 Da
Appearance: White lyophilized solid
Solubility: water or saline buffer
CAS number: Not available
Source: Synthetic
Purity rate: > 95 %
Catalog N : 13PHX003
Protoxin I (ProTx-I)
Protoxin I: properties
Protoxin I (ProTx I; β-theraphotoxin-Tp1a) is a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula). This toxin reversibly inhibits the tetrodotoxin (TTX)-resistant channel Nav1.8 (IC50 = 27 nM) and TTX sensitive Nav channels such Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation.
Product Specification
AA sequence: Glu-Cys2-Arg-Tyr-Trp-Leu-Gly-Gly-Cys9-Ser-Ala-Gly-Gln-Thr-Cys15-Cys16-Lys-His-Leu-Val-Cys21-Ser-Arg-Arg-His-Gly-Trp-Cys28-Val-Trp-Asp-Gly-Thr-Phe-Ser
Disulfide bridges: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28
Length (aa): 35
Formula: C171H245N53O47S6
Molecular Weight: 3987.50 Da
Appearance: White lyophilized solid
Solubility: water or saline buffer
CAS number: Not available
Source: Synthetic
Purity rate: > 95 %
Catalog N : 12PTX001
Obtustatin
Obtustatin: Toxin Properties
Obtustatin is a 41 amino acid disintegrin peptide isolated from the venom of the Vipera lebetina obtusa. It is a potent (IC50 = 2 nM) and selective inhibitor of the binding of α1β1 integrin to collagen IV. Contrary to other known disintegrins, it does not contain the classical RGD sequence. Does not show inhibitory activity toward other integrins, including α2β1, αIIbβ3, αvβ3, α4β1, α5β1, α6β1, and α9β1, α4β7 integrins. Obtustatin potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half.
Product Specifications
AA sequence: Cys1-Thr-Thr-Gly-Pro-Cys6-Cys7-Arg-Gln-Cys10-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys19-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys29-Thr-Gly-Lys-Ser-Cys34-Asp-Cys36-Pro-Leu-Tyr-Pro-Gly-OH
(Disulfide bonds between Cys1-Cys10, Cys6-Cys29, Cys7-Cys34 and Cys19-Cys36)
Length (aa): 41
Formula: C184H284N52O57S8
Molecular Weight: 4393.13 Da
Appearance: White lyophilized solid
Solubility: aqueous buffer
CAS number: not available
Source: Synthetic
Purity rate: > 97 %
Catalog N: 10OBT001
Recombinant Protein
| Product Name: |
Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
|
| Product Type: | Recombinant Protein | |
| Application: | Immunogen,ELISA | |
| Code: | CSB-YP321587AXQ >> Yeast CSB-EP321587AXQ >> E.coli CSB-BP321587AXQ >> Baculovirus CSB-MP321587AXQ >> Mammalian cell |
|
| Size: | 1mg | |
| Protein Names: | Recommended name: 37 kDa salivary gland allergen Aed a 2 Alternative name(s): Protein D7 Allergen= Aed a 2 |
|
| Gene Names: | Name:D7 ORF Names:AAEL006424 |
|
| Species: |
Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
|
| Product Info: | His tagged | |
| Purity: | >90% | |
| Storage Buffer: | PBS pH 7.4, 50% glycerol | |
| Storage: | Store at -20℃, for extended storage, conserve at -20℃ or -80℃. | |
| Notes: | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. | |
| AA sequence: |
STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA FNLPKKQVYSKPAVQSQVMEIDGK QCPQ |
|
| Expression Region: | 18-321 | |
Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
CSB-YP321587AXQ >> Yeast € 2090/ mg
CSB-EP321587AXQ >> E.coli € 1680/ mg
CSB-BP321587AXQ >> Baculovirus € 2540/200ug
CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
Expression Region :18-321aa;full length.
Gardnerella Vaginalis Z125, titered (1 mL)
PRODUCT DESCRIPTION:
Each frozen aliquot contains 1 mL of a pure, titered culture Gardnerella vaginalis. The identification of this organism was confirmed by 16S sequencing. The purity of the culture was monitored by Gram staining and by additional culturing. The titer was performed on one aliquot after freezing. The freezing medium contains 15% glycerol as a cryoprotectant. Please see the Certificate of Analysis for the specific freezing medium used.
INTENDED USE:
Live, titered microorganisms can be used to determine a limit of detection (LOD), in diagnostic assay development or crossreactivity studies. When used as a control for nucleic acid tests, the same protocols as those used to amplify clinical specimens should be employed.
BIOSAFETY:
Gardnerella vaginalis is a biosafety level 2 microorganism and must be used within Biological Safety Level 2 facility or cabinet. Please consult your institution’s regulations regarding the use of this organism. For a detailed discussion on biological safety see
the 5th edition of Biosafety in Microbiological and Biomedical Laboratories (BMBL), published by the CDC.
Agarose ready-to-use flask
Limited promotion offer!
Click here to download PDF file
Order now!
| Cat. Nº | PRODUCT | Pack Size |
| 9008 | AGAROSE D1 , 1% TAE, Non toxic Stain | 12 x 100 ml Flask |
| 9009 | AGAROSE D1 , 1% TAE, Non toxic Stain | 10 x 200 ml Flask |
| 9015 | AGAROSE D1 , 2% TAE, Non toxic Stain | 12 x 100 ml Flask |
| 9017 | AGAROSE D1 , 2% TAE, Non toxic Stain | 10 x 200 ml Flask |
| 9034 | AGAROSE D1 , 3% TAE, Non toxic Stain | 12 x 100 ml Flask |
| 9035 | AGAROSE D1 , 3% TAE, Non toxic Stain | 10 x 200 ml Flask |
| 9013 | AGAROSE MS, 3% TAE, Non Toxic Stain | 12 x 100 ml Flask |
| 9036 | AGAROSE MS, 3% TAE, Non Toxic Stain | 10 x 200 ml Flask |
| 9037 | AGAROSE LM Sieve, 4 % TAE Non Toxic Stain | 12 x 100 ml Flask |
| 9038 | AGAROSE LM Sieve, 4 % TAE Non Toxic Stain | 10 x 200 ml Flask |
More: Agarose
MultiGel-21 for Chemiluminescence analysis
Dear Customers,
Gentaur Worldwide is happy to announce that our new product MultiGel-21 is available for sale. It is capable of working on common DNA Gel documentation and also Chemiluminescence detection for western blot and other blot. All our image system is equipped with cool CCD and this high sensitive CCD mount on our common DNA gel documentation lead to more accurate quantitative data. The product is also very affordable.

Specifications:
1. CCD Capture system, 1/2" microlens, grayscale image.
2. -25C cool CCD, high sensitivity for weak signal.
3. Resolution: 1392(H)x1040(V), (1,447,000 pixels/ expandable5, 790,000 pixels).
4. Preview resolution: 1392(H)x1040(V), twice faster.
5. filter selector: mounted on top of machine, easy to insert filter or take off filter. 4 filter well, rotated selection, dark box with EtBr filter. (Option: other
wavelength / SYBR Green filter, SYPRO Ruby filter)
6. Quantitative resolution: 16 bits, 65535 scale.
7. Filter wavelength: 600 nm x 1ea
8. Exposure time: 0,001 seconds to 100,000 seconds (>24 hours).
9. Application: EtBr Gel, SYBR Green Gel, SyPRO Orange Gel, SYPRO Ruby, western blot, X-ray film, TLC, Tissue Selection, Commasie blue Gel, Coloty plate, Realtime
electrophoresis, chemiluminescence.
10. Computer connection: be able to connect with notebook, or PC
11. Zoom Lens: 8-48 mm / f1.2, (option: 8-48mm / f1.0)
12. reflectance light: white, 8wX2. (option: UV light, 254nm, 306nm, 365nm)
13. safety door: automatic shut down UV when door is open, can switch to continue light on when door is open for gel cutting.
14. quantitate each band intensity, can merge different color image, image calculation, area calculation, length calculation, 3D image display.
15. Option: flexible fluorescent lamp for real time electrophoresis or fluorescent sample, wavelength 440 nm, flexible tube, can be adjust any angle position.
16. UV wavelength: 306 nm, 15W x 6 tubes, fast lighting up, high and low intensity switch, UV view size = 200 x 200 mm (Option: other wavelength selection, 2254 nm, 365nm
or dual wavelength 254 + 365 nm, view size = 20x35cm).
17. Realtime Electrophoresis: continuously tracking and record the proceeding gel images, prevent DNA band run over from gel area.
18. UV LightBox can move in and out freely. Convenience for cutting gel operation.
19. Two hand-operated doors located on the left and right side. UV resistant window open with two layers of UV resistant protection.








