Contact Us

GENTAUR Europe

 GENTAUR Europe BVBA
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45 
Fax 0032 16 50 90 45
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it. 

Gentaur Bulgaria

 GENTAUR BULGARIA
53 Iskar Str. 1191 Kokalyane, Sofia
Tel 0035924682280 
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR France

     GENTAUR France SARL
    9, rue Lagrange, 75005 Paris 
    Tel 01 43 25 01 50 
    Fax 01 43 25 01 60
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Germany

    This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-size: 12px; line-height: 1.3em;">

      GmbH Marienbongard 20
    52062 Aachen Deutschland
    Tel (+49) 0241 56 00 99 68 
    Fax (+49) 0241 56 00 47 88 This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-family: Arial, Tahoma, Verdana, Helvetica; line-height: 15.59375px; ">
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-size: 12px; line-height: 1.3em;">

    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur London

     GENTAUR Ltd. 
    Howard Frank Turnberry House 
    1404-1410 High Road 
    Whetstone London N20 9BH 
    Tel 020 3393 8531 
    Fax 020 8445 9411
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Poland

     GENTAUR Poland Sp. z o.o. 

    ul. Grunwaldzka 88/A m.2

    81-771 Sopot, Poland
    Tel  058 710 33 44
    Fax 058 710 33 48 
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Nederland

     GENTAUR Nederland BV
    Kuiper 1 
    5521 DG Eersel Nederland
    Tel 0208-080893 
    Fax 0497-517897
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Italy

     GENTAUR SRL IVA IT03841300167

    Piazza Giacomo Matteotti, 6, 24122 Bergamo
    Tel 02 36 00 65 93 
    Fax 02 36 00 65 94
    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Spain

     GENTAUR Spain
    Tel 0911876558
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Genprice USA

    usa-flagGenprice Inc, Logistics
    547, Yurok Circle
    San Jose, CA 95123
    Phone/Fax: 

    (408) 780-0908 

    This email address is being protected from spambots. You need JavaScript enabled to view it.

    skype chat

    GENPRICE Inc. invoicing/ accounting:
    6017 Snell Ave, Suite 357
    San Jose, CA. 96123

     

    Gentaur Serbia

    serbiaSerbia, Macedonia FlagMacedonia, 

    montenegro-flagMontenegro, croatiaCroatia: 
    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Romania

    romGENTAUR Romania

    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Greece

    grGENTAUR Greece 

    Tel 00302111768494 
    Fax 0032 16 50 90 45

    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Other countries

    Other countries
    Luxembourg +35220880274
    Schweiz Züri +41435006251
    Danmark +4569918806
    Österreich +43720880899
    Ceská republika Praha +420246019719
    Ireland Dublin +35316526556
    Norge Oslo +4721031366
    Finland Helsset +358942419041
    Sverige Stockholm +46852503438
    Magyarország Budapest +3619980547

    seal-in-search-symantec

     

     

    Monday, 15 July 2013 10:42

    10% Discount on Markers

    Gentaur is now offering 10% summer discount on Markers (for September 2013)

    gentaur-markers-dna-polymerase-polyclonal

    Cat. Product Quantity Old Price Promo Price Order
    GFP-1020 Green Fluorescent Protein 4.0 mg 10x400 ul @ 10.0 mg/ml 352 € 317 € Order
    TUJ Beta-Tubulin 3 ("TUJ1 Antigen"), Neuron Cell Marker 10x300 ug 362 € 326 € Order
    NUN Neu-N (Fox 3), Neuron Cell Marker 10x100 ug 362 € 326 € Order
    MAP Microtubule-Associated Protein (MAP-2), Neuron Cell Marker 10x200 ug 362 € 326 € Order
    MBP Meylin Basic Protein (MBP), Neuron Cell Marker 10x100 ug 362 € 326 € Order
    CAT Choline Acetyltransferase (ChAT), Neuron Cell Marker 10x100 ug 362 € 326 € Order
    TYH Tyrosine Hydroxylase (TYH), Neuron Cell Marker 10x200 ug 362 € 326 € Order
    NES Nestin, Stemcell Marker 10x300 ug 362 € 326 € Order
    PZO P-Zero Myelin Protein (PZO), Schwann Cell Marker 10x200 ug 362 € 326 € Order
    GFAP Glial Fibrillary Acidic Protein (GFAP), Astrocyte Marker 10x200 ul @ 2.0 mg/ml. 221 € 199 € Order
    Published in Promos
    Tagged under
    Friday, 12 July 2013 18:05

    Cultrex® 3-D Spheroid Colorimetric Proliferation/Viability Assay

    The 3-D Spheroid Colorimetric Proliferation/Viability Assay provides a useful tool for modeling tumor response in vitro. The kit utilizes a 3-D Culture Qualified 96 Well Spheroid Formation Plate alongside a specialized Spheroid Formation ECM to drive aggregation and/or spheroid formation of cells. Upon completion of spheroid formation, the spheroid may be treated with pharmacological agents to evaluate tumor viability after drug treatment. Tumor spheroid expansion is visualized microscopically and can be quantitated through image analysis software for real-time and label free evaluation. At the conclusion of the assay, cell viability may be assessed by absorbance using MTT. The 3-D Spheroid Colorimetric Proliferation/Viability Assay offers an in vitro, standardized, threedimensional, high content format for inducing multicellular tumor spheroid (MCTS) formation and quantitating cell viability within the spheroids in response to pharmacological treatment.

     

     

    Catalog # Product Name Size
    3511-096-K Cultrex® 3-D Spheroid Colorimetric Proliferation/Viability Assay 96 samples

     

    Order Button1

     

     

     

     

     

    Published in Promos
    Tagged under
    Friday, 12 July 2013 18:01

    Cultrex® 3-D Spheroid Fluorometric Proliferation/Viability Assay

    The 3-D Spheroid Fluorometric Proliferation/Viability Assay provides a useful tool for modeling tumor response in vitro. The kit utilizes a 3-D Culture Qualified 96 Well Spheroid Formation Plate alongside a specialized Spheroid Formation ECM to drive aggregation and/or spheroid formation of cells. Upon completion of spheroid formation, the spheroid may be treated with pharmacological agents to evaluate tumor viability after drug treatment. Tumor spheroid expansion is visualized microscopically and can be quantitated through image analysis software for real-time and label free evaluation. At the conclusion of the assay, cell viability may be assessed by fluorescence using Resazurin. The 3-D Spheroid Fluorometric Proliferation/Viability Assay offers an in vitro, standardized, three-dimensional, high content format for inducing multicellular tumor spheroid (MCTS) formation and quantitating cell viability within the spheroids in response to pharmacological treatment.

    Catalog # Product Name Size
    3510-096-K Cultrex® 3-D Spheroid Fluorometric Proliferation/Viability Assay 96 samples

     

    Order Button1

     

    Published in Promos
    Tagged under
    Friday, 12 July 2013 17:46

    Phrixotoxin 3 (Paurtx 3)

    Phrixotoxin-3: properties

    Phrixotoxin-3  (PaurTx3 or Beta-theraphotoxin-Ps1a) is a valuable pharmacological tool to study voltage-gated sodium channels. This peptide, originally issued from the venom of the tarantula phrixotrichus auratus, has been shown to inhibit Nav1.1, Nav1.2, Nav1.3, Nav1.4 and Nav1.5 with respective IC50 values of 610 nM, 0.6 nM, 42 nM, 288 nM and 72 nM. It is thus considered as one of the most potent and almost selective modulator of Nav1.2. 

    Product Specification

    AA sequence: Asp-Cys2-Leu-Gly-Phe-Leu-Trp-Lys-Cys9-Asn-Pro-Ser-Asn-Asp-Lys-Cys16-Cys17-Arg-Pro-Asn-Leu-Val-Cys23-Ser-Arg-Lys-Asp-Lys-Trp-Cys30-Lys-Tyr-Gln-Ile-OH
    Disulfide bridges: Cys2-Cys17, Cys9-Cys23, and Cys16-Cys30
    Length (aa): 34
    Formula: C171H245N53O47S6
    Molecular Weight: 4059.9 Da
    Appearance: White lyophilized solid
    Solubility: water or saline buffer
    CAS number: Not available
    Source: Synthetic 
    Purity rate: > 95 %

    Catalog N : 13PHX003

    Order Button1

    Published in Promos
    Tagged under
    Friday, 12 July 2013 17:41

    Protoxin I (ProTx-I)

    Protoxin I: properties

    Protoxin I (ProTx I; β-theraphotoxin-Tp1a) is a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula). This toxin reversibly inhibits the tetrodotoxin (TTX)-resistant channel Nav1.8 (IC50 = 27 nM) and TTX sensitive Nav channels such Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation.

    Product Specification

    AA sequence: Glu-Cys2-Arg-Tyr-Trp-Leu-Gly-Gly-Cys9-Ser-Ala-Gly-Gln-Thr-Cys15-Cys16-Lys-His-Leu-Val-Cys21-Ser-Arg-Arg-His-Gly-Trp-Cys28-Val-Trp-Asp-Gly-Thr-Phe-Ser
    Disulfide bridges: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28
    Length (aa): 35
    Formula: C171H245N53O47S6
    Molecular Weight: 3987.50 Da
    Appearance: White lyophilized solid
    Solubility: water or saline buffer
    CAS number: Not available
    Source: Synthetic 
    Purity rate: > 95 %

    Catalog N : 12PTX001

    Order Button1

    Published in Promos
    Tagged under
    Friday, 12 July 2013 17:33

    Obtustatin

    Obtustatin: Toxin Properties

    Obtustatin is a 41 amino acid disintegrin peptide isolated from the venom of the Vipera lebetina obtusa. It is a potent (IC50 = 2 nM) and selective inhibitor of the binding of α1β1 integrin to collagen IV.  Contrary to other known disintegrins, it does not contain the classical RGD sequence. Does not show inhibitory activity toward other integrins, including α2β1, αIIbβ3, αvβ3, α4β1, α5β1, α6β1, and α9β1, α4β7 integrins. Obtustatin potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half.

    Product Specifications

    AA sequence: Cys1-Thr-Thr-Gly-Pro-Cys6-Cys7-Arg-Gln-Cys10-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys19-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys29-Thr-Gly-Lys-Ser-Cys34-Asp-Cys36-Pro-Leu-Tyr-Pro-Gly-OH
    (Disulfide bonds between Cys1-Cys10, Cys6-Cys29, Cys7-Cys34 and Cys19-Cys36)
    Length (aa): 41
    Formula: C184H284N52O57S8
    Molecular Weight: 4393.13 Da
    Appearance: White lyophilized solid
    Solubility: aqueous buffer
    CAS number: not available
    Source: Synthetic
    Purity rate: > 97 %

    Catalog N: 10OBT001

    Order Button1

    Published in Promos
    Tagged under
    Friday, 12 July 2013 14:15

    Recombinant Protein

    Product Name:

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
    Product Type: Recombinant Protein
    Application: Immunogen，ELISA
    Code: CSB-YP321587AXQ   >>   Yeast
    CSB-EP321587AXQ   >>   E.coli
    CSB-BP321587AXQ   >>   Baculovirus
    CSB-MP321587AXQ   >>   Mammalian cell
    Size: 1mg
    Protein Names: Recommended name:
    37 kDa salivary gland allergen Aed a 2
    Alternative name(s):
    Protein D7
    Allergen= Aed a 2
    Gene Names: Name:D7
    ORF Names:AAEL006424
    Species:

    Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
    Product Info: His tagged
    Purity: >90%
    Storage Buffer: PBS pH 7.4, 50% glycerol
    Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
    Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
    AA sequence:
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG
    LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL
    DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA
    FNLPKKQVYSKPAVQSQVMEIDGK QCPQ
     
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYA...... 
    Expression Region: 18-321

     

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    CSB-YP321587AXQ >> Yeast € 2090/ mg
    CSB-EP321587AXQ >> E.coli € 1680/ mg
    CSB-BP321587AXQ >> Baculovirus € 2540/200ug
    CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
    Expression Region ：18-321aa；full length.

    Order Button1

    Published in Promos
    Tagged under
    Friday, 12 July 2013 10:13

    Gardnerella Vaginalis Z125, titered (1 mL)

    Gardnerella Vaginalis Gentaur antibodiesPRODUCT DESCRIPTION:
    Each frozen aliquot contains 1 mL of a pure, titered culture Gardnerella vaginalis. The identification of this organism was confirmed by 16S sequencing. The purity of the culture was monitored by Gram staining and by additional culturing. The titer was performed on one aliquot after freezing. The freezing medium contains 15% glycerol as a cryoprotectant. Please see the Certificate of Analysis for the specific freezing medium used.

    INTENDED USE:
    Live, titered microorganisms can be used to determine a limit of detection (LOD), in diagnostic assay development or crossreactivity studies. When used as a control for nucleic acid tests, the same protocols as those used to amplify clinical specimens should be employed.

    BIOSAFETY:
    Gardnerella vaginalis is a biosafety level 2 microorganism and must be used within Biological Safety Level 2 facility or cabinet. Please consult your institution’s regulations regarding the use of this organism. For a detailed discussion on biological safety see
    the 5th edition of Biosafety in Microbiological and Biomedical Laboratories (BMBL), published by the CDC.

    Download PDF

    Order Button1

    Published in Promos
    Tagged under
    Thursday, 11 July 2013 17:10

    Agarose ready-to-use flask

    agarose gentaur ready-to-use flask

    Limited promotion offer!

    Click here to download PDF file

    icon-order-reportsOrder now!

     

       
       
    Cat. Nº PRODUCT Pack Size
    9008 AGAROSE D1 , 1% TAE, Non toxic Stain 12 x 100 ml  Flask
    9009 AGAROSE D1 , 1% TAE, Non toxic Stain 10 x 200 ml  Flask
    9015 AGAROSE D1 , 2% TAE, Non toxic Stain 12 x 100 ml  Flask
    9017 AGAROSE D1 , 2% TAE, Non toxic Stain 10 x 200 ml  Flask
    9034 AGAROSE D1 , 3% TAE, Non toxic Stain 12 x 100 ml  Flask
    9035 AGAROSE D1 , 3% TAE, Non toxic Stain 10 x 200 ml  Flask
    9013 AGAROSE  MS, 3% TAE, Non Toxic Stain 12 x 100 ml  Flask
    9036 AGAROSE MS, 3% TAE, Non Toxic Stain 10 x 200 ml  Flask
    9037 AGAROSE LM Sieve, 4 % TAE Non Toxic Stain 12 x 100 ml  Flask
    9038 AGAROSE LM Sieve, 4 % TAE Non Toxic Stain 10 x 200 ml  Flask

     

    More: Agarose

    Published in Promos
    Tagged under
    Thursday, 11 July 2013 16:56

    MultiGel-21 for Chemiluminescence analysis

     

    Dear Customers,

     

    Gentaur Worldwide is happy to announce that our new product MultiGel-21 is available for sale. It is capable of working on common DNA Gel documentation and also Chemiluminescence detection for western blot and other blot. All our image system is equipped with cool CCD and this high sensitive CCD mount on our common DNA gel documentation lead to more accurate quantitative data. The product is also very affordable.

    multigel overview

     

    Specifications:

    1. CCD Capture system, 1/2" microlens, grayscale image.
    2. -25C cool CCD, high sensitivity for weak signal.
    3. Resolution: 1392(H)x1040(V), (1,447,000 pixels/ expandable5, 790,000 pixels).
    4. Preview resolution: 1392(H)x1040(V), twice faster.
    5. filter selector: mounted on top of machine, easy to insert filter or take off filter. 4 filter well, rotated selection, dark box with EtBr filter. (Option: other
    wavelength / SYBR Green filter, SYPRO Ruby filter)
    6. Quantitative resolution: 16 bits, 65535 scale.
    7. Filter wavelength: 600 nm x 1ea
    8. Exposure time: 0,001 seconds to 100,000 seconds (>24 hours).
    9. Application: EtBr Gel, SYBR Green Gel, SyPRO Orange Gel, SYPRO Ruby, western blot, X-ray film, TLC, Tissue Selection, Commasie blue Gel, Coloty plate, Realtime
    electrophoresis, chemiluminescence.
    10. Computer connection: be able to connect with notebook, or PC
    11. Zoom Lens: 8-48 mm / f1.2, (option: 8-48mm / f1.0)
    12. reflectance light: white, 8wX2. (option: UV light, 254nm, 306nm, 365nm)
    13. safety door: automatic shut down UV when door is open, can switch to continue light on when door is open for gel cutting.
    14. quantitate each band intensity, can merge different color image, image calculation, area calculation, length calculation, 3D image display.
    15. Option: flexible fluorescent lamp for real time electrophoresis or fluorescent sample, wavelength 440 nm, flexible tube, can be adjust any angle position.
    16. UV wavelength: 306 nm, 15W x 6 tubes, fast lighting up, high and low intensity switch, UV view size = 200 x 200 mm (Option: other wavelength selection, 2254 nm, 365nm
    or dual wavelength 254 + 365 nm, view size = 20x35cm).
    17. Realtime Electrophoresis: continuously tracking and record the proceeding gel images, prevent DNA band run over from gel area.
    18. UV LightBox can move in and out freely. Convenience for cutting gel operation.
    19. Two hand-operated doors located on the left and right side. UV resistant window open with two layers of UV resistant protection.

     

    multigel specification

     

    callforprice

     

     

    Published in Promos
    Tagged under
    Page 10 of 18