Contact Us

GENTAUR Europe

 GENTAUR Europe BVBA
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45 
Fax 0032 16 50 90 45
This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it. 

Gentaur Bulgaria

 GENTAUR BULGARIA
53 Iskar Str. 1191 Kokalyane, Sofia
Tel 0035924682280 
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR France

     GENTAUR France SARL
    9, rue Lagrange, 75005 Paris 
    Tel 01 43 25 01 50 
    Fax 01 43 25 01 60
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Germany

    This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-size: 12px; line-height: 1.3em;">

      GmbH Marienbongard 20
    52062 Aachen Deutschland
    Tel (+49) 0241 56 00 99 68 
    Fax (+49) 0241 56 00 47 88 This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-family: Arial, Tahoma, Verdana, Helvetica; line-height: 15.59375px; ">
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    This email address is being protected from spambots. You need JavaScript enabled to view it." style="font-size: 12px; line-height: 1.3em;">

    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur London

     GENTAUR Ltd. 
    Howard Frank Turnberry House 
    1404-1410 High Road 
    Whetstone London N20 9BH 
    Tel 020 3393 8531 
    Fax 020 8445 9411
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Poland

     GENTAUR Poland Sp. z o.o. 

    ul. Grunwaldzka 88/A m.2

    81-771 Sopot, Poland
    Tel  058 710 33 44
    Fax 058 710 33 48 
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Nederland

     GENTAUR Nederland BV
    Kuiper 1 
    5521 DG Eersel Nederland
    Tel 0208-080893 
    Fax 0497-517897
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Italy

     GENTAUR SRL IVA IT03841300167

    Piazza Giacomo Matteotti, 6, 24122 Bergamo
    Tel 02 36 00 65 93 
    Fax 02 36 00 65 94
    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Spain

     GENTAUR Spain
    Tel 0911876558
    This email address is being protected from spambots. You need JavaScript enabled to view it." style="">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Genprice USA

    usa-flagGenprice Inc, Logistics
    547, Yurok Circle
    San Jose, CA 95123
    Phone/Fax: 

    (408) 780-0908 

    This email address is being protected from spambots. You need JavaScript enabled to view it.

    skype chat

    GENPRICE Inc. invoicing/ accounting:
    6017 Snell Ave, Suite 357
    San Jose, CA. 96123

     

    Gentaur Serbia

    serbiaSerbia, Macedonia FlagMacedonia, 

    montenegro-flagMontenegro, croatiaCroatia: 
    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Romania

    romGENTAUR Romania

    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Greece

    grGENTAUR Greece 

    Tel 00302111768494 
    Fax 0032 16 50 90 45

    This email address is being protected from spambots. You need JavaScript enabled to view it.">This email address is being protected from spambots. You need JavaScript enabled to view it.

    Other countries

    Other countries
    Luxembourg +35220880274
    Schweiz Züri +41435006251
    Danmark +4569918806
    Österreich +43720880899
    Ceská republika Praha +420246019719
    Ireland Dublin +35316526556
    Norge Oslo +4721031366
    Finland Helsset +358942419041
    Sverige Stockholm +46852503438
    Magyarország Budapest +3619980547

    seal-in-search-symantec

     

     

    Friday, 12 July 2013 14:15

    Recombinant Protein

    Rate this item
    (1 Vote)
    Product Name:

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    Product Type: Recombinant Protein
    Application: Immunogen,ELISA
    Code: CSB-YP321587AXQ   >>   Yeast
    CSB-EP321587AXQ   >>   E.coli
    CSB-BP321587AXQ   >>   Baculovirus
    CSB-MP321587AXQ   >>   Mammalian cell
    Size: 1mg
    Protein Names: Recommended name:
    37 kDa salivary gland allergen Aed a 2
    Alternative name(s):
    Protein D7
    Allergen= Aed a 2
    Gene Names: Name:D7
    ORF Names:AAEL006424
    Species:

    Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    Product Info: His tagged
    Purity: >90%
    Storage Buffer: PBS pH 7.4, 50% glycerol
    Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
    Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
    AA sequence:
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG
    LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL
    DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA
    FNLPKKQVYSKPAVQSQVMEIDGK QCPQ
     
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYA...... 
    Expression Region: 18-321

     

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    CSB-YP321587AXQ >> Yeast € 2090/ mg
    CSB-EP321587AXQ >> E.coli € 1680/ mg
    CSB-BP321587AXQ >> Baculovirus € 2540/200ug
    CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
    Expression Region :18-321aa;full length.

    Order Button1

    Read 2352 times