Contact Us

GENTAUR Europe

 GENTAUR Europe BVBA
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45 
Fax 0032 16 50 90 45
This email address is being protected from spambots. You need JavaScript enabled to view it.  

Gentaur Bulgaria

 GENTAUR BULGARIA
53 Iskar Str. 1191 Kokalyane, Sofia
Tel 0035924682280 
Fax 0035929830072
This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR France
    Gentaur Germany

      GmbH Marienbongard 20
    52062 Aachen Deutschland
    Tel (+49) 0241 56 00 99 68 
    Fax (+49) 0241 56 00 47 88 
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    This email address is being protected from spambots. You need JavaScript enabled to view it.

     

    Gentaur London

     GENTAUR Ltd. 
    Howard Frank Turnberry House 
    1404-1410 High Road 
    Whetstone London N20 9BH 
    Tel 020 3393 8531 
    Fax 020 8445 9411
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Poland

     GENTAUR Poland Sp. z o.o. 

    ul. Grunwaldzka 88/A m.2

    81-771 Sopot, Poland
    Tel  058 710 33 44
    Fax 058 710 33 48 
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Nederland

     GENTAUR Nederland BV
    Kuiper 1 
    5521 DG Eersel Nederland
    Tel 0208-080893 
    Fax 0497-517897
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Gentaur Italy

     GENTAUR SRL IVA IT03841300167

    Piazza Giacomo Matteotti, 6, 24122 Bergamo
    Tel 02 36 00 65 93 
    Fax 02 36 00 65 94
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Spain

     GENTAUR Spain
    Tel 0911876558
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Genprice USA
    Gentaur Serbia

    serbiaSerbia, Macedonia FlagMacedonia, 

    montenegro-flagMontenegro, croatiaCroatia: 
    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Romania

    romGENTAUR Romania

    Tel 0035929830070 
    Fax 0035929830072
    This email address is being protected from spambots. You need JavaScript enabled to view it.

    GENTAUR Greece

    grGENTAUR Greece 

    Tel 00302111768494 
    Fax 0032 16 50 90 45

    This email address is being protected from spambots. You need JavaScript enabled to view it.

    Other countries

    Other countries
    Luxembourg +35220880274
    Schweiz Züri +41435006251
    Danmark +4569918806
    Österreich +43720880899
    Ceská republika Praha +420246019719
    Ireland Dublin +35316526556
    Norge Oslo +4721031366
    Finland Helsset +358942419041
    Sverige Stockholm +46852503438
    Magyarország Budapest +3619980547

    seal-in-search-symantec

     

     

    Displaying items by tag: ELISA
    Monday, 27 October 2014 13:24

    Rabbit polyclonal antibody

    Code

    04-rb-anti-ERα17p-500                         04-rb-anti-ERα17p-200

    Size

    500 µL                                                   200 µL

    Price

    385 Euros                                              175 Euros

    Product Name

    ERα17p rabbit polyclonal antibody

    Product type

    Primary antibodies

    Immunogen

    ERα17p is a synthetic peptide corresponding to a regulatory motif located within the autonomous AF-2a region of the estrogen receptor α (ERα)

    Tested applications

    ELISA, WESTERN BLOT

    Application notes

    Recommended dilutions

    ELISA: serum: 1/20-1/1000        antigen: 2 µg/mL-5 µg/mL

    WESTERN BLOTserum: 1/100-1/2000            antigen: 10-8-10-5M

    Raised in

    Rabbit

    Clonality

    Polyclonal

    Storage buffer

    0.1% azide

    Form

    Liquid

    storage instructions

    Store at +4°C short term (1 week). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Expiration

    31/12/2015

    Published in Promos
    Monday, 07 April 2014 16:26

    EIAgen 25OH-Vitamin D

     EIAgen 25OH-Vitamin

               -    Semi liquid Calibrators and Controls 

            o   Stability of reconstituted Calibrators and Controls up to 8 weeks at 2-8° or 4 months at -20°

         -     24 months Shelf life

         -     Breakable wells

         -     Optical Density <3.0

    The 25-Hydroxyvitamin D Total ELISA is powered by unique monoclonal antibodies that express 100% reactivity against 25 OH Vitamin D3 and 83% reactivity against 25 OH Vitamin D2. All in one technology. No extraction step, displacement solution directly into the well. Results in less than 4 hours. Calibrated against ID-LC/MS-MS (reference method). Bar codes an all components.

    tubes1

    Price for this unique Assay, CE and FDA approved:

    Cat#

    Description

    Kit

    Quantity

    Price

    GDMS 1971

    25OH Vitamin D Total ELISA

    96T

    1-10

    € 125

    GDMS 1971

    25OH Vitamin D Total ELISA

    96T

    11-50

    € 119

    GDMS 1971

    25OH Vitamin D Total ELISA

    96T

    >50

    € 110

     

    More: Vitamin D Total ELISA

     

     

     

     

     

     

     

     

    Published in Promos
    Monday, 06 January 2014 15:28

    Bovine Cystocercosis ELISA

    The GENTAUR Bovine living cysticercosis ELISA is based on 2 mouse monoclonal antibodies that detect only protein of living Cystocerkosis infections. The ELISA can detect Cystocercosis from as low as 10 infections in one adult cattle on 500 ul of crude serum.

    The results on Urine are not 100% accurate due to false positives.

    bottleswenhnjhnjhnjName: Bovine living cysticercosis ELISA

    Product reference: 04-bov-cysto-ELISA

    Price: 455 Euro / 96 wells

    Use: Low detection of living infections, not quantitative but qualitative

    Deze ELISA geeft een juiste diagnose in  100% van alle positieve gevallen, wanneer er meer dan 10 cysticercen aanwezig zijn in het karkas( keuringsverslag) Indien er tussen de 1 en 10 cysticercen aanwezig zijn daalt dit naar 65%. In theorie is 1 cysticerc voldoende om een mens te infecteren.

     

    bottleswenhnjhnjhnjName:  Rabbit polyclonal anti living bovine cystocercosis

    Product reference: 04-bov-cysto-rab500

    Price: 195 Euro / 500ul

    Use: crude rabbit serum used for WB 1/500, ELISA capture antibody

    Bovine cystocercosis is a parasitic disease that afflicts the muscles of cattle and is caused by larvae of the human tapewormTaenia Saginata. If people consume beef containing these parasites they can acquire intestinal tapeworm infections.

    Bovine cystercosis, also known as bladder worm or beef tape worm, is a parasitc zoonosis due to the cestode Taenia saginata. It causes few symptoms in the animal but it is an important zoonosis.

    Classification

    OIE, List B disease

    Susceptible species

    The beef is a intermediate host and man is the final host.

    Distribution

    Bovine cysticervosis is worldwilde distributed. In the Pacific it is only reported in Australia and New Zealand.

    Clinical signs 

    In animals there is usually no clinical sign associated. However heavy infections may cause myocarditis andheart failure associated with developing cysts in the heart.

    Post-mortem findings 

    Lesions consist of cysticerci in cysts, they are 5-8 mm by 3-5 mm, translucid and filled with a brownish to pinkish liquid, sometimes the 'head' of the metacestodes can be see as a white spot. Cysts are essentially found in the following muscles:

      •    - Heart,
    •    - Tongue,
    •    - Masseters and Diaphragm,
    •    - Shoulder muscles
    •    - Intercostal muscles,
    •    - Oesaphage

    More rarely cysts are found in the liver, the lungs and the brain.

    Differential diagnosis 

    Lesions must be differentiated from sarcosporidiosis and toxoplasmosis.

    Specimens required for diagnosis 

    The diagnosis is usually made during meat inspection. However serologic test has been developed.

    Transmission

    Beef usually get infected by grazing on pasture contaminated by human feces (which can come from sewage water or direct pollution). Occasionally in-utero contamination occurs.

    Human get infected by eating unproperly cooked meat (<60°C)

    Risk of introduction   

    Introduction could occur through importation of infected cattle, meat or material contaminated by human feces. Humans can also introduce it into the country.

    Control / vaccines 

    Control is done through public hygien and proper meat inspection at slaughterhouse.

    Cysts can be destroyed by freezing  at -18°C for 5 days or at -10°C for 10 days or by cooking at 56°C for 5 minutes.

    References

    •    - BUSSIERAS J, CHERMETTE R, Helminthologie In Parasitologie Vétérinaire, Ecole Nationale Vétérinaire D'Alfort, 1992, p 237-241;
    •    - Office International des Epizooties, 2002
    •    - SOULSBY EJL, Helminths, Echinococcus In Helminths, Arthropods and Protozoa of Domesticated Animals, Lea and Febiger Inc, 7th ed, 1982, Philadelphia, p 107-111
    •    - The importation into New Zealand of Meat and Meat Products, Stuart C. McDiarmid, Wellington, 1991, p. 65-67

     

    Detectietest ter confirmatie van de visuele postmortem diagnose van rundercysticercose

    IWT project 080132

    Order Button1

    Published in Promos
    Wednesday, 24 July 2013 16:48

    Elisa Microplate Reader-SPR960

    elisa microplate reader gentaurAdvanced optical system

    1. 8 channel optical fiber system enables 5 secs' reading for 96 well plate
    2. Auto position function, ensures accurate results
    3. Bichromatic measurement, Multi-calculation methods include ABS, Cut-off , Linearity and Log.
    4. 405nm, 450nm, 492nm, 630nm, 4 free positions

     

    Intelligent software

    1. Big LCD, question and answer mode for program, humanity design, easy to operate
    2. PC controlled, Elisa WorkStation Function
    3. Self-test enables normal condition for any operate
    4. Plate shaking modes editable, enables excellent mixing, giving the reliable results
    5. Multi-test Methods, qualitative and Quantitative Test
    6. Critical value analysis, quantitative analysis, quality control etc
    7. Large storage capacity for 28 test programs
    8. Intelligent Operating software, able to communicate with PC


    Specifications

    1. Plate Type: 96 or 48 well plate or strips
    2. Reading Speed: 5 second for 96 well plate
    3. Light Source: Cold light source
    4. Wavelength Range: 340~750nm
    5. Filters: 405nm, 450nm, 492nm, 630nm, 4 open positions
    6. Linearity range: ±1%(0.000-2.000Abs)
    7. Measure Mode: Monochromatic , Bichromatic
    8. Plate shaking : Time &Speed adjustable
    9. Display: 240*128LCD
    10. Interface: Bi-directional LIS interface for data transfer and handling
    11. Power supply: AC220V/110V±10%,50/60Hz
    12. Dimension: 440(L)mmX305(W)mmX154(H)mm
    13. Net weight: 7kg

    Price: 1400 Euro

    Order Button1

     

    More: Elisa Microplate Reader

    Published in Promos
    Friday, 12 July 2013 14:15

    Recombinant Protein

    Product Name:

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    Product Type: Recombinant Protein
    Application: Immunogen,ELISA
    Code: CSB-YP321587AXQ   >>   Yeast
    CSB-EP321587AXQ   >>   E.coli
    CSB-BP321587AXQ   >>   Baculovirus
    CSB-MP321587AXQ   >>   Mammalian cell
    Size: 1mg
    Protein Names: Recommended name:
    37 kDa salivary gland allergen Aed a 2
    Alternative name(s):
    Protein D7
    Allergen= Aed a 2
    Gene Names: Name:D7
    ORF Names:AAEL006424
    Species:

    Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    Product Info: His tagged
    Purity: >90%
    Storage Buffer: PBS pH 7.4, 50% glycerol
    Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
    Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
    AA sequence:
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKA HKDTSKNLFHGNKELTKG
    LYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYT VLDDALFKEHTDCVMKGIRYITKNNEL
    DAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSN AGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYA
    FNLPKKQVYSKPAVQSQVMEIDGK QCPQ
     
    STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTG LYDPVAQKF
    DASVIQEQFKAYPSLGEKSKVEAYA...... 
    Expression Region: 18-321

     

    Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2(D7) for Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

    CSB-YP321587AXQ >> Yeast € 2090/ mg
    CSB-EP321587AXQ >> E.coli € 1680/ mg
    CSB-BP321587AXQ >> Baculovirus € 2540/200ug
    CSB-MP321587AXQ >> Mammalian cell € 2980/200ug
    Expression Region :18-321aa;full length.

    Order Button1

    Published in Promos
    Friday, 14 June 2013 14:06

    CA 15-3 ELISA Kit

    ca15-3-elisa-kitINTENDED USE
    The CA15-3 for the quantitative determination of the Cancer Antigen CA15-3 concentration in human serum. This kit is intended for research use only.

    SUMMARY AND EXPLANATION
    Breast cancer is the most common life-threatening malignant lesion in women of many developed countries today, with approximately 180,000 new cases diagnosed every year. Roughly half of these newly diagnosed patients are node-negative, however 30% of these cases progress to metastatic disease.
    There are a number of tumor markers that can help clinicians to identify and diagnose which breast cancer patients will have aggressive disease and which will have an indolent course. These markers include estrogen and progesterone receptors, DNA ploidy and percent-S phase profile, epidermal growth factor receptor, HER-2/neu oncogene, p53 tumor suppressor gene, cathepsin D, proliferation markers and CA15-3. CA15-3 is most useful for monitoring patients post-operatively for recurrence, particularly metastatic
    diseases. 96% of patients with local and systemic recurrence have elevated CA15-3, which can be used to predict recurrence earlier than radiological and clinical criteria. A 25% increase in the serum CA15-3 is associated with progression of carcinoma. A 50% decrease in serum CA15-3 is associated with response to treatment. CA15-3 is more sensitive than CEA in early detection of breast cancer recurrence. In combination with CA125, CA15-3 has been shown to be useful in early detection of relapse of ovarian
    cancer. CA15-3 levels are also increased in colon, lung and hepatic tumors.

    PRINCIPLE OF THE TEST
    The CA15-3 ELISA test is based on the principle of a solid phase enzyme-linked immunosorbent assay. The assay system utilizes a monoclonal antibody directed against a distinct antigenic determinant on the intact CA15-3 molecule is used for solid phase immobilization (on the microtiter wells). A rabbit anti-CA15-3 antibody conjugated to horseradish peroxidase (HRPO) is in the antibody-enzyme conjugate solution. The test sample is allowed to react sequentially with the two antibodies, resulting in the CA15-3 molecules being sandwiched between the solid phase and enzyme-linked antibodies. After two separate 1-hour incubation steps at 37C, the wells are washed with water to remove unbound labeled antibodies. A solution of TMB Reagent is added and incubated for 20 minutes, resulting in the development of a blue color. The color development is stopped with the addition of Stop Solution changing the color to yellow. The concentration of CA15-3 is directly proportional to the color intensity of the test sample. Absorbance is measured spectrophotometrically at 450 nm.

     

    Download PDF

    Order Button1

    Published in Top Products
    Friday, 17 May 2013 16:14

    Human Tenascin C Elisa Kit (TNC)

    P63316

    Antigen: Tenascin C (TNC)

    Synonyms: TN, HXB, MGC167029, Hxb, Ten, TN-C, AI528729, MGC144208, MGC144209, cytotactin, tenascin-C, C130033P17Rik, tenc, wu:fk04d02, TNC, tn, MGC140517

    Quantity: 96 Tests/kit

    Components:

    1. Assay plate (12 x 8 coated Microwells). Quantity: 1(96 wells)
    2. Standard (Freeze dried). Quantity: 2
    3. Biotin-antibody (100 x concentrate) Quantity: 1 x 120 µl
    3.HRP-avidin (100 x concentrate). Quantity: 1 x 120 µl
    4. Biotin-antibody Diluent. Quantity: 1 x 10 ml
    5. HRP-avidin Diluent. Quantity: 1 x 10 ml
    6. Sample Diluent. Quantity: 1 x 20 ml
    7. Wash Buffer (25 x concentrate). Quantity: 1 x 20 ml
    8. TMB Substrate. Quantity: 1 x 10 ml
    9. Stop Solution. Quantity: 1 x 10 ml
    10. Adhesive Strip (For 96 wells). Quantity: 4
    11. Instruction manual

    Description Synonyms: CMD1Z, TNC, TNNC, cardiac troponin C|slow twitch skeletal/cardiac muscle troponin C|troponin C, slow|troponin C1, slow

    Sensitivity: The sensitivity of this assay, or Lower Limit of Detection (LLD) was defined as the lowest protein concentration that could be differentiated from zero. It was determined the mean O.D value of 20 replicates of the zero standard added by their three standard deviations.

    Minimum Detection Limit: 0.195 ng/mL

    Detection Range: 0.78 ng/mL - 50 ng/mL

    Assay Precision: 
    Intra-assay Precision (Precision within an assay): CV%<8% Three samples of known concentration were tested twenty times on one plate to assess.
    Inter-assay Precision (Precision between assays): CV%<10% Three samples of known concentration were tested in twenty assays to assess.

    Price: 1087 EUR

    Order Button1

    Published in Top Products
    Thursday, 09 May 2013 14:38

    25OH Vitamin D Total, ELISA, 96 tests

    The Gentaur 25OH Vitamin D Total ELISA is a solid phase Enzyme Linked Immunosorbent Assay performed on microtiterplates. During a first 2 hours incubation step, at room temperature, total 25OH Vitamin D (D2 and D3) present in calibrators, controls and samples is dissociated from binding serum proteins to fix on binding sites of a specific monoclonal antibody. After 1 washing step, a fixed amount of 25OH Vitamin D-labelled with biotin in presence of horseradish peroxidise (HRP), compete with unlabelled 25OH Vitamin D2 and 25OH Vitamin D3 present on the binding sites of the specific monoclonal antibody. After a 30 minutes incubation at room temperature, the microtiterplate is washed to stop the competition reaction. The Chromogenic solution (TMB) is added and incubated for 15 minutes. The reaction is stopped with the addition of Stop Solution and the microtiterplate is then read at the appropriate wavelength. The amount of substrate turnover is determined colourimetrically by measuring the absorbance, which is inversely proportional to the total 25OH Vitamin D (D2 and D3) concentration. A calibration curve is plotted and the total 25OH Vitamin D (D2 and D3) concentrations of the samples are determined by dose interpolation from the calibration curve.

      

    Price: 250 €Order Button1

      

    Technical spec.:

    Catalog # KAP1971
    Format ELISA
    Label HRP
    Size 96 tests
    Sample Type Serum
    Sample Volume 50 µL
    Controls 2 levels
    Range 0-180 ng/mL
    Sensitivity 1,4 ng/mL
    Incubation 120min./30 min./15 min
    Shelf Life (weeks) 32

    pdfDownload "Instructions for Use": KAP1971.pdf

    Published in Promos
    Thursday, 18 April 2013 12:41

    Rat IgG ELISA

    Immunology KitsINTENDED USE

    The IMMUNO-TEK Rat IgG ELISA* Kit is a rapid, easy to use enzyme linked immunosorbent assay (ELISA) designed for the measurement of rat IgG in rat serum, plasma, saliva, mucosa, cell culture fluid from rat cells or other biological sample. The assay contains ready-to-use reagents and takes less than two hours to perform. The microplate and detector antibody in the kit react with all subclasses of rat IgG.

    * Research Purposes Only.  Not For in vitro Diagnostic Use.

    PRINCIPLE OF THE TEST

    Microplate wells coated with polyclonal antibodies to rat IgG form the capture phase of the assay. Rat IgG specimen samples along with the supplied standard are diluted appropriately with Assay Diluent and are then incubated in the microplate wells. After a wash step, captured rat IgG in the well is incubated with detector antibody, a polyclonal anti-rat IgG conjugated to horseradish peroxidase (HRP). This antibody reacts only to the Fc portion of the immunoglobulin molecule allowing for the specific detection of IgG. After another wash step, the chromogenic substrate tetramethyl benzidine (TMB) is added and a blue color develops in proportion to the amount of rat IgG that has been bound to the antibody-coated plate. The enzyme reaction is stopped by the addition of Stop Solution which results in a color change to yellow which can be measured spectrophotometrically at 450 nm. The concentrations of rat IgG are then calculated from a standard curve.

    Order Button1

    PDF-IconDownload Rat IgG ELISA Datasheet

    PDF-IconDownload SeroDetect West Nile Virus Panel

    Published in Promos
    Wednesday, 03 April 2013 09:55

    Parasitology: Cysticercosis Antigen ELISA

    Apdia beeld hersenscanThe Cysticercosis Antigen (Ag) ELISA (Ref. 650501) is a sandwich Enzyme-Linked ImmunoSorbent Assay based on monoclonal antibodies for the qualitative determination of viable metacestodes (cysticerci) of Taenia spp. in human and porcine serum samples.

    -  Analytical sensitivity: 1 cyst is detectable in certain conditions
    - Incubation times: assay 45 minutes + sample prep <30 minutes
    - Available format: 96T


    Taenia solium cysticercosis is an infection of humans and pigs with metacestode larvae (cysticercus) of Taenia solium. Circulating antigen detection in serum is an important diagnostic method that indicates the presence of viable parasites. The monoclonal antibodies used in this assay are produced against excretory secretory products (ESP) of viable T. saginata cysticerci. The glycoprotein antigens detected by these monoclonal antibodies are present on the tegument and in the excretory secretory products of metacestodes.

    The assay demonstrates the presence of viable cysticerci only, it does not detect degenerated or calcified cysticerci. In this respect, unlike antibody detection, measurement of circulating antigen levels allows differentiation of cysticercosis cases with viable parasites, with antigen levels correlating to the numbers and size of lesions. It can as such also provide a tool for serological monitoring of antiparasitic therapy in human or pigs: antigen levels drop rapidly after successful anthelminthic treatment.

    Porcine cysticercosis

    The assay is genus specific, not species specific. The assay does not allow the differentiation between infections of different Taenia species in pigs. In experimentally infected pigs, circulating antigens were first detected between 2 and 6 weeks post infection and remained present generally throughout an observation period of 6 months, even in pigs carrying only five to eight living cysts. The minimum number of living cysts, that could be detected using the Cysticercosis Ag ELISA, was one.

    Human cysticercosis

    Because T. solium is the only Taenia sp. causing cysticercosis in man, the test is specific. No cross-reactions were observed with sera from patients with other parasitologically and/or serologically confirmed infections. The sensitivity of the assay decreases when the number of viable cysts is low; infections with one viable cyst are often not detectable. Antigen levels are generally higher in extraparenchymal neurocysticercosis (NCC) (particularly subarachnoid NCC) than in intraparenchymal NCC; therefore, high antigen levels should lead one to suspect the presence of extraparenchymal NCC.

    Order Button1

    PDF-IconDownload datasheet

     

    Published in Promos
    Page 1 of 2